SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066394 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066394
Domain Number 1 Region: 2233-2497
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-51
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 472-733
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-44
Family YWTD domain 0.0000106
Further Details:      
 
Domain Number 3 Region: 1422-1666
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-39
Family YWTD domain 0.0000111
Further Details:      
 
Domain Number 4 Region: 3090-3360
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-38
Family YWTD domain 0.0000279
Further Details:      
 
Domain Number 5 Region: 1118-1344
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-35
Family YWTD domain 0.0000369
Further Details:      
 
Domain Number 6 Region: 780-1045
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-24
Family YWTD domain 0.00052
Further Details:      
 
Domain Number 7 Region: 1768-1809
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 8 Region: 2178-2226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000159
Family EGF-type module 0.008
Further Details:      
 
Domain Number 9 Region: 299-340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 10 Region: 2020-2061
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 181-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 12 Region: 2060-2102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 13 Region: 2661-2700
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000969
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 14 Region: 139-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000982
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 2619-2662
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 16 Region: 2752-2789
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 2787-2827
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 18 Region: 1938-1974
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 19 Region: 2544-2580
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 20 Region: 2831-2868
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 1890-1931
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 22 Region: 2103-2143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 23 Region: 96-136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 54-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 25 Region: 387-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.012
Further Details:      
 
Domain Number 26 Region: 1732-1776
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 27 Region: 2874-2908
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 2959-2996
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 29 Region: 2145-2193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000359
Family EGF-type module 0.017
Further Details:      
 
Domain Number 30 Region: 1846-1892
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 31 Region: 1052-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family EGF-type module 0.025
Further Details:      
 
Domain Number 32 Region: 219-257
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 33 Region: 416-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000629
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 34 Region: 260-297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 35 Region: 2582-2623
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000126
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 36 Region: 2916-2954
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 37 Region: 344-380
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 38 Region: 1977-2021
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000105
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 39 Region: 1814-1850
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 40 Region: 2715-2748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 41 Region: 3041-3074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000454
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 42 Region: 3001-3042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000066394
Domain Number - Region: 3415-3446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 735-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000187
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1375-1420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000491
Family EGF-type module 0.0087
Further Details:      
 
Domain Number - Region: 6-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 2502-2563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00135
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1687-1748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0152
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 3360-3445
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0471
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066394   Gene: ENSRNOG00000047711   Transcript: ENSRNOT00000070816
Sequence length 3692
Comment pep:novel chromosome:Rnor_5.0:3:62271279:62359283:-1 gene:ENSRNOG00000047711 transcript:ENSRNOT00000070816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSNYCSQTTHANGDCSHFCFPVPNFQRVCGCPYGMKLQRDQMTCEGDPAREPPTQQCGS
LSFPCNNGKCVPSFFRCDGVDDCHDNSDEHQCGVFNNTCSPSAFACVRGGQCIPGQWHCD
RQNDCLDGSDEQNCPTHATSSTCPSTSFTCDNHVCIPKDWVCDTDNDCSDGSDEKNCQAS
GTCQPTQFRCPDHRCISPLYVCDGDKDCADGSDEAGCVLNCTSAQFKCADGSSCINSRYR
CDGVYDCRDNSDEAGCPTRPPGMCHLDEFQCQGDGTCIPNTWECDGHPDCIHGSDEHTGC
VPKTCSPTHFLCDNGNCIYKAWICDGDNDCRDMSDEKDCPTQPFHCPSTQWQCPGYSTCI
NLSALCDGVFDCPNGTDESPLCNQDSCSHFNGGCTHQCMQGPFGATCLCPLGYQLANDTK
TCEDINECDIPGFCSQHCVNMRGSFRCACDPEYTLESDGRTCKVTGSENPLLVVASRDKI
IVDNITAHTHNLYSLVQDVSFVVALDFDSVTGRVFWSDLLQGKTWSVFQNGTDKRVVHDS
GLSVTEMIAVDWIGRNLYWTDYALETIEVSKIDGSHRTVLISKNVTKPRGLALDPRMGDN
VMFWSDWGHHPRIERASMDGTMRTVIVQEKIYWPCGLSIDYPNRLIYFMDAYLDYIEFCD
YDGHNRRQVIASDLVLHHPHALTLFEDFVYWTDRGTRQVMQANKWHGGNQSVVMYSVHQP
LGITAIHPSRQPPSRNPCASASCSHLCLLSAQAPRHYSCACPSGWNLSDDSVNCVRGDQP
FLMSVRDNIIFGISLDPEVKSNDAMVPISGIQHGYDVEFDDSEQFIYWVENPGLWIRILA
SGANVSPVPSCLRLFLSSWKQSVTVRKVQGRSPGSREERVLTLKGDTRYGKTLIANDGTP
LGVGFPVGIAVDPARGETIWSDHGTDSGVPAKIASANMDGTSLKILFTGNLQHLEVVTLD
IQEQKLYWAVTSRGVIERGNVDGTERMILVHHLAHPWGLVVYGSFLYYSDEQYEVIERVD
KSSGNNKVVLRDNVPYLRGLRVYHRRNAADSSNGCSNNPNACQQICLPVPGGMFSCACAS
GFKLSPDGRSCSPYNSFMVVSMLPAVRGFSLELSDHSEAMVPVAGQGRNVLHADVDVANG
FIYWCDFSSSVRSSNGIRRIKPDGSNFTNVVTYGIGANGIRGVALDWAAGNLYFTNAFVY
ETLIEVLRINTTYRRVLLKVSVDMPRHIIVDPKHRYLFWADYGQKPKIERSFLDCTNRTV
LVSEGIVTPRGLAMDHDTGYIYWVDDSLDLIARIHLDGGESQVVRYGSRYPTPYGITVFG
ESIIWVDRNLKKVFQASKQPGNTDPPVVIRDKINLLRDVTIFDEHAQPLSPAELNNNPCL
QSNGGCSHFCFALPELPTPRCGCAFGTLGNDGKSCATSQEDFLIYSLNNSLRSLHFDPRD
HSLPFQVISVAGTAIALDYDRRNNRIFFTQKLNSLRGQISYVSLYSGSSSPTVLLSNIGV
TDGIAFDWINRRIYYSDFSNQTINSMAEDGSNRAVIARVSKPRAIVLDPCRGYMYWTDWG
TNAKIERATLGGNFRVPIVNTSLVWPNGLALDLETDLLYWADASLQKIERSTLTGTNREV
VVSTAFHSFGLTVYGQYIYWTDLYTRKIYRANKYDGSDLVAMTTRLPTQPSGISTVVKTQ
RQQCSNPCDQFNGGCSHICAPGPNGAECQCPHEGNWYLANDNKYCVVDTGTRCNQLQFTC
LNGHCINQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTCGNGRCVPYHYRCDYYNDCG
DNSDEAGCLFRNCNSTTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNCPPHTCPPDFT
KCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQCLSPQRCIPSYWFCDGE
ADCADGSDEPDTCGHSVNTCRASQFQCDNGRCISGNWVCDGDNDCGDMSDEDQRHHCELQ
NCSSTQFTCVNSRPPNRRCIPQYWVCDGDADCSDALDELQNCTMRTCSAGEFSCANGRCV
RQSFRCDRRNDCGDYSDERGCSYPPCHANQFTCQNGRCIPRFFVCDEDNDCGDGSDEQEH
LCHTPEPTCPLHQFRCDNGHCIEMGRVCNHVDDCSDNSDEKGCGINECLDSSISRCDHNC
TDTITSFYCSCLPGYKLMSDKRSCVDIDECKESPQLCSQKCENVVGSYICKCAPGYIREP
DGKSCRQNSNIEPYLIFSNRYYIRNLTTDGSSYSLILQGLGNVVALDFDRVEKRLYWIDA
EKQIIERMFLNKTNRETIINHRLRRAESLAVDWVSRKLYWLDAILDCLFVSDLEGRHRKM
IAQHCVDANNTFCFEHPRGIVLHPQRGHVYWADWGVHAYIGRIGMDGTNKSVIISTKIEW
PNAITIDYTNDLLYWADAHLGYIEFSDLEGHHRHTVYDGSLPHPFALTIFEDTVFWTDWN
TRTVEKGNKYDGSGRVVLVNTTHKPFDIHVYHPYRQPIMSNPCGTNNGGCSHLCLIKAGG
RGFTCACPDDFQTVQLRDRTLCMPMCSSTQFLCGNNEKCIPIWWKCDGQKDCSDGSDEPD
LCPHRFCRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCESNEWQCANKRC
IPQSWQCDSVNDCLDNSDEDTSHCASRTCRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE
PIDECTTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCESVPCHPSGDFR
CANHHCIPLRWKCDGTDDCGDNSDEENCVPRECSESEFRCADQQCIPSRWVCDQENDCGD
NSDERDCEMKTCHPEHFQCTSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAM
FECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNIPCESPQRFRCDNSRCVYGHQLCNGV
DDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCISQHYVCDNVNDCGDLSDETGCNLGD
NRTCAENICEQNCTQLSSGGFICSCRPGFKPSTLDKNSCQDINECEEFGICPQSCRNSKG
SYECFCVDGFKSMSTHYGERCAADGSPPLLLLPENVRIRKYNTSSEKFSEYLEEEEHIQT
IDYDWDPEHIGLSVVYYTVLAQGSQFGAIKRAYIPNFESGSNNPIREVDLGLKYLMQPDG
LAVDWVGRHIYWSDAKSQRIEVATLDGRYRKWLITTQLDQPAAIAVNPKLGLMFWTDQGK
QPKIESAWMNGEHRSVLVSENLGWPNGLSIDYLNDDRVYWSDSKEDVIEAIKYDGTDRRL
IINEAMKPFSLDIFEDKLYWVAKEKGEVWRQNKFGKENKEKVLVVNPWLTQVRIFHQLRY
NQSVSNPCKQVCSHLCLLRPGGYSCACPQGSDFVTGSTVQCDAASELPVTMPPPCRCMHG
GNCYFDENELPKCKCSSGYSGEYCEVGLSRGIPPGTTMAVLLTFVIVIIVGALVLVGLFH
YRKTGSLLPTLPKLPSLSSLAKPSENGNGVTFRSGADVNMDIGVSPFGPETIIDRSMAMN
EHFVMEVGKQPVIFENPMYAAKDNTSKVALAVQGPSTGAQVTVPENVENQNYGRPIDPSE
IVPEPKPASPGADEIQGKKWNIFKRKPKQTTNFENPIYAEMDSEVKDAVAVAPPPSPSLP
AKASKRNLTPGYTATEDTFKDTANLVKEDSDV
Download sequence
Identical sequences ENSRNOP00000066394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]