SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066573 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066573
Domain Number 1 Region: 72-127
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-17
Family Fibronectin type II module 0.0023
Further Details:      
 
Domain Number 2 Region: 39-81
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000714
Family Fibronectin type II module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066573   Gene: ENSRNOG00000046669   Transcript: ENSRNOT00000071105
Sequence length 131
Comment pep:novel chromosome:Rnor_5.0:1:77147222:77155527:-1 gene:ENSRNOG00000046669 transcript:ENSRNOT00000071105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEVMSHLVGWALLAVYIYGLNAELISHLHPPKQDFSNTTCVFPFVYADEFHYSCISIRSD
YDWCSLDFHFQGRWRYCTAQDPPKCVFPFQFKQKSIKTCTKDGFILNRSWCSLTDNYNRD
RKWKQCSPYNF
Download sequence
Identical sequences ENSRNOP00000066573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]