SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066973 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000066973
Domain Number - Region: 275-312
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000123
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066973   Gene: ENSRNOG00000047525   Transcript: ENSRNOT00000071361
Sequence length 337
Comment pep:novel chromosome:Rnor_5.0:X:107513881:107514894:1 gene:ENSRNOG00000047525 transcript:ENSRNOT00000071361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEETFENWLSQVHEVLPDWPMSEEDKIKRLMRTLRGPAREAMRLFQADNPNLNVAEFLRA
MKLLFGESESSITAHGKFLNTLQAQGEKPSLYVIRLEVQLQNAIQAGVLPQSEANRTRLH
QLLVGAELSRELRIKLKGLLQMHAHNEQESLPDFLELIRMIREEEDWDETFLRNKRPRRS
ETVMERAASPVVFQGSLPIVIGSADCNVIEIDDSQDDSDEDVILVEPEDPPLSSPGTSSL
RGTVSTQEEMLVIESPDESDEESPSTSSGSGQRNNGPGDVGRTRKRKYPIRCPHCGEEGH
AKETCDNTSNKGQVFENLIVTLQELTHMERPKPPAPY
Download sequence
Identical sequences ENSRNOP00000066973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]