SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067074 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067074
Domain Number 1 Region: 56-109
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000314
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000067074
Domain Number - Region: 6-69
Classification Level Classification E-value
Superfamily Globin-like 0.0981
Family Phycocyanin-like phycobilisome proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067074   Gene: ENSRNOG00000048392   Transcript: ENSRNOT00000073651
Sequence length 137
Comment pep:novel chromosome:Rnor_5.0:X:472505:477150:1 gene:ENSRNOG00000048392 transcript:ENSRNOT00000073651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMSTKFLQSSSIRELKPKISQNILENENIIFFDTFHKVMNTDSSCTKSPGDILKPEKMSK
SFKDISKYFSEEEWAKLTKWQKSAYIFMKRNYIRMTDLGVMVNQPVFMRGKDQITESLMK
ESDIFDMEHTKGLKVSI
Download sequence
Identical sequences M0RBX4
ENSRNOP00000067074 ENSRNOP00000067552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]