SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067084 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067084
Domain Number 1 Region: 5-134
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.3e-24
Family L-arabinose binding protein-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067084   Gene: ENSRNOG00000048196   Transcript: ENSRNOT00000075324
Sequence length 169
Comment pep:novel chromosome:Rnor_5.0:4:55140797:55141662:-1 gene:ENSRNOG00000048196 transcript:ENSRNOT00000075324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSIRVDGDIILGGLFPVHAKGERGVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNIT
LGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASS
VSIMVANILRLFKVGKDVAFSTVVKESAILTTIAHLSSRTLPLYLRNIR
Download sequence
Identical sequences M0RBY2
ENSRNOP00000067084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]