SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067235 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067235
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 9.12e-48
Family C-type lysozyme 0.000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067235   Gene: ENSRNOG00000045622   Transcript: ENSRNOT00000075264
Sequence length 160
Comment pep:known chromosome:Rnor_5.0:X:907618:910801:-1 gene:ENSRNOG00000045622 transcript:ENSRNOT00000075264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFCSTVVVILATLLLATVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFD
TSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVS
SHKSMKAWDSWTRHCAGHDLSEWLKGCDVPLKADSNYDDW
Download sequence
Identical sequences M0RCC1
ENSRNOP00000067235 NP_001101528.1.100692 NP_001101528.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]