SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067296 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067296
Domain Number 1 Region: 29-121
Classification Level Classification E-value
Superfamily Immunoglobulin 2.59e-27
Family V set domains (antibody variable domain-like) 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067296   Gene: ENSRNOG00000050931   Transcript: ENSRNOT00000072382
Sequence length 145
Comment pep:novel chromosome:Rnor_5.0:15:35460634:35461206:1 gene:ENSRNOG00000050931 transcript:ENSRNOT00000072382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKILTASFLLLGLHLAGVSGQQERRDQQQVKQSPQSLTVWEGGTTVLNCSYEDSTFSYF
PWYQQFPGEGPVLLIAISSVSYKKEDGRFTVFLRKSEKRLSLHIEDSQPGDSATYFCAAR
AQCSPHTCSPDPNLQLRLQQSPAAG
Download sequence
Identical sequences M0R4C9
ENSRNOP00000064211 ENSRNOP00000067296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]