SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067369 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067369
Domain Number 1 Region: 9-291
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.97e-17
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067369   Gene: ENSRNOG00000049810   Transcript: ENSRNOT00000072551
Sequence length 298
Comment pep:known chromosome:Rnor_5.0:2:187604673:187605569:-1 gene:ENSRNOG00000049810 transcript:ENSRNOT00000072551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQITVDDMVLKVVILLQMGTGLLANTYLLFMHSFVLLTGHRPKPTELILSNLALANSLV
LLSKGAQQVMEDLGLVHVLEGFGCQVFFYFHRVSRELLLCSTSLLSCFQAVTVSPRHGVW
TGLRRWVYRHVGCSCFFCWSFNLVISTISPIEIKVFGDIISNSSMGDGIACQYVVAVSGL
CAIPLAILGALLMTLMVAASTHMVCLLHRHHQRVQHVRSCNLTYRTSPEMRATHSILLLV
AGFILFYFLNSIYIFYSIKSFSSYLWLQHSLKFFATCFPSLSPLVLIFQNSRTPSPCF
Download sequence
Identical sequences M0RCP4
ENSRNOP00000067369 NP_001160235.1.100692 NP_001160235.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]