SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067889 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067889
Domain Number 1 Region: 31-96
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-21
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067889   Gene: ENSRNOG00000047440   Transcript: ENSRNOT00000075304
Sequence length 101
Comment pep:novel chromosome:Rnor_5.0:16:76755110:77059453:1 gene:ENSRNOG00000047440 transcript:ENSRNOT00000075304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAWRKFKSLLLPLVLAVLCAGLLTAAKGQNCGGLVQGPNGTIESPGFPHGYPNYANCTW
IIITGERNRIQLSFHTFALEEDFDILSVYDGQPQQGNLKVR
Download sequence
Identical sequences ENSRNOP00000067889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]