SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000812 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000812
Domain Number 1 Region: 84-167
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.48e-30
Family Nuclear receptor 0.00016
Further Details:      
 
Domain Number 2 Region: 152-166,273-367
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000000433
Family Nuclear receptor ligand-binding domain 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000812   Gene: ENSRNOG00000000653   Transcript: ENSRNOT00000000812
Sequence length 368
Comment pep:known chromosome:Rnor_5.0:13:58794163:58910799:-1 gene:ENSRNOG00000000653 transcript:ENSRNOT00000000812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASSITGDFQDFLKHGLPAIGAGLPDRHRRPIPARSRLVMLPKVETEASGLVRSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNQKRY
TCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTSAIQNIHSASKGLPLSHVALPPTDYDRSPFVT
SPISMTMPPHGSLHGYQPYGHFPNRAIKSEYPDPYSSSPESMMGYSYMDGYQTSSPASIP
HLILELLKCEPDEPQVQAKIMAYLQQEQNNRNRQEKLSAFGLLCKMADQTLFSIVEWARS
SIFFRELK
Download sequence
Identical sequences ENSRNOP00000000812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]