SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001815 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001815
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-27
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 47-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-21
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 5 Region: 378-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 164-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000638
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001815   Gene: ENSRNOG00000001341   Transcript: ENSRNOT00000001815
Sequence length 439
Comment pep:novel chromosome:Rnor_5.0:12:21336802:21352518:-1 gene:ENSRNOG00000001341 transcript:ENSRNOT00000001815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADHASQEPRPLLESTLSSSKVPSFPDKDSLGDKMLAAALLKAKSQELVTFEDVAVY
FIWKEWKRLEPAQRDLYRDVMLENYGNVFSLDGDSKTGNDQVISEGMGSCEMILGRFQKD
VSQGLKFEEAYEQEVSLQRQLGSSSVGRLNRKIQEFHQVRVEKKLTHMGERNEKYSEFGN
NFTVNSKLTSHQRLPMGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQ
SAHLIQHQRIHTGEKPYECKDCGKTFSCSSALILHQRIHTGEKPYECNECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLNVMGEKQKFRQPVC
Download sequence
Identical sequences ENSRNOP00000001815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]