SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003605 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003605
Domain Number 1 Region: 826-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000921
Family Laminin-type module 0.0000536
Further Details:      
 
Domain Number 2 Region: 722-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000753
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 284-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 4 Region: 882-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.00013
Further Details:      
 
Domain Number 5 Region: 933-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 445-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 396-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 771-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.00018
Further Details:      
 
Domain Number 9 Region: 340-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 10 Region: 981-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000003605
Domain Number - Region: 1281-1524
Classification Level Classification E-value
Superfamily Tropomyosin 0.000405
Family Tropomyosin 0.0016
Further Details:      
 
Domain Number - Region: 98-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00383
Family Galactose-binding domain 0.04
Further Details:      
 
Domain Number - Region: 1080-1274
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0227
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.011
Further Details:      
 
Domain Number - Region: 685-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0642
Family Laminin-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003605   Gene: ENSRNOG00000002680   Transcript: ENSRNOT00000003605
Sequence length 1607
Comment pep:known chromosome:Rnor_5.0:13:75622195:75749168:-1 gene:ENSRNOG00000002680 transcript:ENSRNOT00000003605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGGRRAALALQLQRRLWLLLAVLAAVACWVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQLHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFGK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESANQCLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFSCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDTYFPRYFVAPAKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGACDPGFYNLQSGQGCESCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDETVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNNSLHSQISRLHNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARRLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALESEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASGVQKNATS
TKADAERTFSEVTDLDNEVNGMLRQLEEAENELKRKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLTDLLEQLGQLDTVDLNKLNEIEGSLNKAKDEMKVSDLDRKVSNLE
NEARKQEAAILDYDRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
Download sequence
Identical sequences F1MAA7
NP_446418.1.100692 NP_446418.1.4139 ENSRNOP00000003605 10116.ENSRNOP00000003605 ENSRNOP00000003605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]