SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003934 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003934
Domain Number 1 Region: 140-427
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-93
Family Nuclear receptor ligand-binding domain 0.000000000654
Further Details:      
 
Domain Number 2 Region: 36-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.79e-26
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003934   Gene: ENSRNOG00000002906   Transcript: ENSRNOT00000003934
Sequence length 431
Comment pep:known chromosome:Rnor_5.0:11:67024186:67060494:-1 gene:ENSRNOG00000002906 transcript:ENSRNOT00000003934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPEERWNHVGLVQREEADSVLEEPINVDEEDGGLQICRVCGDKANGYHFNVMTCEGCKG
FFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRA
LIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSDCE
LPEVLQASLLEDPATWSQIMKDSVPMKISVQLRGEDGSIWNYQPPSKSDGKEIIPLLPHL
ADVSTYMFKGVINFAKVISHFRELPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGR
LAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLREEEYVLMQAISLFSPDRPGVVQRSVVD
QLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDTHPFATP
LMQELFSSTDG
Download sequence
Identical sequences Q9R1A7
ENSRNOP00000003934 ENSRNOP00000003934 10116.ENSRNOP00000003934 NP_443212.1.100692 NP_443212.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]