SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004764 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004764
Domain Number 1 Region: 149-260
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000738
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 292-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000567
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 3 Region: 261-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000004764
Domain Number - Region: 333-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000923
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00519
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004764   Gene: ENSRNOG00000003553   Transcript: ENSRNOT00000004764
Sequence length 493
Comment pep:known chromosome:Rnor_5.0:14:112892387:112984799:1 gene:ENSRNOG00000003553 transcript:ENSRNOT00000004764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQTVFLTMLTLALVKSQVTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETPAAEASSGAATGTIAARSMATSGVIPGGGFIA
SATAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTSG
THNCRLDQVCINLRGSFTCHCLPGYQKRGEQCVDIDECSVPPYCHQGCVNTPGSFYCQCN
PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT
SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRCY
PQNPCQDPYVLTSENRCVCPVSNTMCRDVPQSIVYKYMNIRSDRSVPSDIFQIQATTIYA
NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLTGPREHIVDLEMLTVSSIGTFRTSS
VLRLTIIVGPFSF
Download sequence
Identical sequences Q6AXN2
ENSRNOP00000004764 NP_001012039.1.100692 NP_001012039.1.4139 XP_008768678.1.100692 XP_008768679.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]