SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005071 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005071
Domain Number 1 Region: 52-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-72
Family Calnexin/calreticulin 0.0000000389
Further Details:      
 
Domain Number 2 Region: 260-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.15e-58
Family P-domain of calnexin/calreticulin 0.000000371
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000005071
Domain Number - Region: 401-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000348
Family Calnexin/calreticulin 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005071   Gene: ENSRNOG00000003755   Transcript: ENSRNOT00000005071
Sequence length 611
Comment pep:known chromosome:Rnor_5.0:19:35523738:35555259:1 gene:ENSRNOG00000003755 transcript:ENSRNOT00000005071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFQGVGLCLGLLFITAKADFVDDGVEVEDFSESSDESDFKDEPSSGTIKYKTPQPIGEV
YFTETFDSGNLSGWVLSKAKKDDMDSEISIYDGRWEIEELKENQVPGDRGLVLKSKAKHH
AISAVLEKPFIFADKPLIVQYEVNFQDGIDCGGAYVKLLADTGDLILENFYDKTSYTIMF
GPDKCGEDYKLHLIFRHKHPKTGVFEEKHAKPPDVDLKEFFTDRKTHLYTLVMNPDDTFE
ILIDQKVVNQGTLLEDVVPPINPPREIDDPNDRKPEEWDDRAKIPDPTAVKPEDWDEKEP
IQIEDPSAVKPDGWLDDEPKFIPNPKAEKPEDWSDSMDGEWEAPHIPNPACQIGCGEWKP
PMIDNPKYKGIWRPPMINNPNYQGIWSPQKIPNPDYFEDDHPFLLTSFSALGLELWSMTP
DIYFDNFIICSEKEVADQWAADGWELKIMVANANEPGVLRQLTTAAEERPWLWLMYLVMA
GLPIALVTSFCWPRKVKKKYEDIGPKKADLCQLPSKAALEQEPEEEKAPEKPEDLQEEKK
PSETEVVIVEKEVIGEPEEKSEEDAETIEGQEEMTKLSKSGSEDEMKDADESTGSGDAPV
KSLRKRRVRKD
Download sequence
Identical sequences D3ZFS2
ENSRNOP00000005071 NP_001102942.1.100692 NP_001102942.1.4139 ENSRNOP00000005071 10116.ENSRNOP00000005071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]