SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005556 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005556
Domain Number 1 Region: 206-435
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.78e-55
Family Voltage-gated potassium channels 0.00081
Further Details:      
 
Domain Number 2 Region: 44-163
Classification Level Classification E-value
Superfamily POZ domain 1.57e-28
Family Tetramerization domain of potassium channels 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005556   Gene: ENSRNOG00000004117   Transcript: ENSRNOT00000005556
Sequence length 503
Comment pep:known chromosome:Rnor_5.0:7:84030573:84037747:-1 gene:ENSRNOG00000004117 transcript:ENSRNOT00000005556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSPRNRPLLDSSSLDSGSLTSLDSSVFCSEGEGEPLALGDCLTVNVGGSRFVLSQQAL
SCFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYY
RTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTDDQESQ
HESEQDFSQGPCPTVRQKLWDILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSWL
NLQLLEILEYVCISWFTGEFILRFLCVKDRCHFLRKVPNIIDLLAILPFYITLLVESLSG
SHTTQELENVGRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI
SIFSTIEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI
LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDIYARSIM
EMLRLKGRERASTRSSGGDDFWF
Download sequence
Identical sequences P97557
NP_067729.1.100692 NP_067729.1.4139 ENSRNOP00000005556 ENSRNOP00000005556 10116.ENSRNOP00000005556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]