SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005670 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005670
Domain Number 1 Region: 345-689
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.75e-42
Family Hect, E3 ligase catalytic domain 0.0084
Further Details:      
 
Domain Number 2 Region: 210-292
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.78e-27
Family PHD domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000005670
Domain Number - Region: 139-198
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00084
Family PHD domain 0.024
Further Details:      
 
Domain Number - Region: 68-106
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0384
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005670   Gene: ENSRNOG00000004232   Transcript: ENSRNOT00000005670
Sequence length 717
Comment pep:known chromosome:Rnor_5.0:6:81659540:81685196:1 gene:ENSRNOG00000004232 transcript:ENSRNOT00000005670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNENKPGNSQSLACVFCRKNDDCPNKYGEKKTCEKWNFSVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVNRASKLKCTVCKKNGASIGCVVPQCKRSYHLPCGLQKECIFQFTDNF
ASFCWKHRPVQAITSNKYRDSLPCTICLEFVEPIPTYNILQSPCCKNAWFHRDCLQVQAI
NAGVFFFRCTLCNNTDIFQKEMLRMGIHIPEKDASWELEENAYQELLQSHDRCDVRRCHC
KEGREYNEPNSKWEIKRCQCCGSSGTHLACSSLQSWEKNWECLDCRRIAYTSDFQKAPKH
PLANSTNVTVTDCLLEESSPKLPRQSTVAQQKELLRQGSKFRRDISTILIELGFQIKKKA
KTLYINKANVWRSAVEQFQSQKFNPSYSIEVVYVNDNDEVGSKHPGSKQEFLSHLMHHLE
NSSVFEGSLAKNLSLNSQAVKENLYYEAGKMLAISLVHGGPSPGFFSETLFKCLAYGPEN
ALPTLDDVSDLDVAQIIIKIDTAADLNILKSVINEYYNYLEFSGCLRLMTTLSDKYMLVK
DILFYQVIKRVKAPFESFKQGLKTLGVLEKIQAYPEAFYNILCHKPESLSAKNLSDLFTI
HKLPDVKTSRFWNSYLQAVEDGKSATTLEDILHFATGCSSVPPTGFKPAPSIECLHGDFP
VANKCNNCLALPVTNTYEEFQENMDFAIRDSIRLEKEERSHLLPRTLNVSSNEEMLF
Download sequence
Identical sequences D3ZC11
NP_001100196.1.100692 NP_001100196.1.4139 XP_006240140.1.100692 XP_006240141.1.100692 XP_017449570.1.100692 ENSRNOP00000005670 10116.ENSRNOP00000005670 ENSRNOP00000005670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]