SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006195 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006195
Domain Number 1 Region: 23-134
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.31e-37
Family Frizzled cysteine-rich domain 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006195   Gene: ENSRNOG00000004660   Transcript: ENSRNOT00000006195
Sequence length 710
Comment pep:known chromosome:Rnor_5.0:7:78317823:78349530:-1 gene:ENSRNOG00000004660 transcript:ENSRNOT00000006195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASPFLSACILLPLIRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQGIAAVEMEH
FLPLANLECSPNIEMFLCQAFVPTCTEQIDVVSPCRKLCEKILSDCQKLMDTFGIRWPEE
LECHRLPYCDGAVPVTSDPHTELFGPQKKTDQVPRDIGFWCPKHLRTSGDQGYRFLGIDQ
CAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFVGFLLGNSTACNKADEKLELGNTVVLGSKNKACSVVFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGMPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYELVNRVTWEMTWFSDHCHQYRIPCPYQANPKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFCKRNRKRDPISESRRVLQESCEFFLKHNSKVRHK
KKHGKPGSHKLKVISKSMGTSTGVTTDHGTSAVAIADHDYLGQETSAEVQTSPEASLKEG
RADRANTPRAKGPDCGEPASTAASNSKFSGDQIDRKSRAGSVKEKSSVSEGAPSEGRVSP
KGVPGTGLMECTLQIPSSPEPNSLKGSTSLLVRSASGTRKEQGAGGHSDT
Download sequence
Identical sequences G3V6L1
NP_001124008.1.100692 NP_001124008.1.4139 XP_017450173.1.100692 XP_017450174.1.100692 XP_017450175.1.100692 ENSRNOP00000006195 ENSRNOP00000006195 10116.ENSRNOP00000006195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]