SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006524 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006524
Domain Number 1 Region: 304-332,364-565
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.68e-59
Family Voltage-gated potassium channels 0.00058
Further Details:      
 
Domain Number 2 Region: 177-273
Classification Level Classification E-value
Superfamily POZ domain 8.9e-27
Family Tetramerization domain of potassium channels 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006524   Gene: ENSRNOG00000004918   Transcript: ENSRNOT00000006524
Sequence length 654
Comment pep:known chromosome:Rnor_5.0:3:104901966:104905092:1 gene:ENSRNOG00000004918 transcript:ENSRNOT00000006524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGTGGSGGG
PHHHHQTRGAYSSHDPQGSRGSRRRRRQRTEKKKLHHRQSSFPHCSDLMPSGSEEKILRE
LSEEEEDEEEEEEEEEEGRFYYSEEDHGDGCSYTDLLPQDDGGGGGYSSVRYSDCCERVV
INVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGG
RLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEY
PESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSAGGHSRLLNDTSAPHL
ENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITL
GTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELG
LLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKI
VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRS
STSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV
Download sequence
Identical sequences G3V6L7
XP_006234735.1.100692 XP_006234736.1.100692 XP_017446982.1.100692 10116.ENSRNOP00000006524 ENSRNOP00000006524 ENSRNOP00000006524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]