SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006830 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006830
Domain Number 1 Region: 330-427
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.02e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000006830
Domain Number - Region: 445-480,889-919,951-1022
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000119
Family WD40-repeat 0.06
Further Details:      
 
Domain Number - Region: 117-178,437-469
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0293
Family WD40-repeat 0.045
Further Details:      
 
Domain Number - Region: 2369-2426
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0693
Family Frizzled cysteine-rich domain 0.0085
Further Details:      
 
Domain Number - Region: 3260-3349
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0841
Family Galactose-binding domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006830   Gene: ENSRNOG00000027191   Transcript: ENSRNOT00000006830
Sequence length 4029
Comment pep:known chromosome:Rnor_5.0:6:31524882:31980891:-1 gene:ENSRNOG00000027191 transcript:ENSRNOT00000006830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAALFPLPRQPRSSLGLAGPAGDVPCACRRLTSLPANALRFAPWPRMVTGCGAAPPGTVT
EPLPSVIVLSAGRKMAAAAAEASGPSCSSAAAAAGAGAAGVSEWLVLRDGCMRCDADGLH
SLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYISAVDKVIFVDD
YAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSACVEKIDVSSTEGYDL
FITQLKDGLKNTSHETAANHKVAKWATVTFHLPHHVLKSIASAIVNELKKINQNVAALPV
ASSVMDRLSYLLPSARPELGVGPGRSVDRALMYSEANRRETFTSWPHVGYRWAQPDPMAQ
AGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFVKGEHTQNVPLSVT
LATSPAQLPSADGADRISCFGSGSCPQFLAAATKRGKICIWDVSKLMKVHLKFEINAYDP
VIVQQLILSGDPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDSDDLLEDSDSEEHSRSDSV
TGHTSQKEAMEVSLDITALSILQQPEKLQWEIVANVLEDTVKDLEELGANPCLTNSKSEK
TKEKHQEQHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGLSRTQGESISEQGSTDNE
SCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEME
LDNQEQLLLQDPPVTYIQQFADAAASLTSPDSEKWNSVFPKPGTLVQCLRLPKFAEEETL
CIDSITPCADGVHLLVGLRTCSVESLSAINQVEALNNLNKLNSALCNRRKGDLESNLAVV
NGANISVIQHESPADVPAPLIIQPEQRNLSGGYLVLYKMNYTTRIVTLEEEPVKIQHIKD
PQDTITSLILLPPDILDNREDDCEEPAEEMQLTSKNGIEREKKSDVSTLGHLVVTTQGGY
VKVLDLSNFEILAKVEPPKKEGTEDQDTFVSVIYCSGTDRLCACTKGGELHFLQIGGTCD
DIDEADILVDGSLSKGIEPSLEGSKSVSNTALTTGVDLLVDQPFTLEILTSLVELTRFET
LTPRFSATVPPCWVEVQQEQQQRRHPQHLHQQHHGDAAQHTRTWKLQTDSNSWDEHVFEL
VLPKACMVGHVDFKFVLNSTITSVPQIQVSLLRNRAPGLGKANALNIEVEQNGNPSLVDL
NEEMHPMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLSGHAGMLTLTSPKLVKGMA
GGKYRSFLIHIKAVSDRGADEVCSSGLRPVVRLPSLKQQGHKGYSLASLLAKVAAGKEKS
SNVKNESAGGTRKSENLRGCDLLQEVSVTIRRFKKTSICKERVQRCAMLQFSEFHEKLLN
TLCRRSDDGLVTEHAQSLVLDTLCWLAGVHSNGPGSSKEGNECLLSKTRTCLSDIVRVCF
FEAGRSIAHKCARFLALCISNGKCDPYQPGFGSVLLKALLDNMCFLPAAATGGSVYWYFV
LLNYVKDEDLAACSTACAALLTAVSRQLQDRLTPLEALLQTRYGLYSSPFDPVLFDLEMS
GSSCKNVYNSSIGVQSDEIDLSDVLSGNGKVSSCTAAEGSFTSLTGLLEVEPLHFTCVST
SDGTRIERDDAMSSFGVTPAVGGLSSGTVGEASTALSSAAQVALQSLSHAMASAEQQLQV
LQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAASAAAAAGPVHNAVPSNPVAAPGFFIHP
SDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSVIDPPAVNLAAHNKNANKS
RMNPLGSGLALAISHASHFLQPPPHQSIIIERMHSGARRFVTLDFGRPILLTDVLIPTCG
DLASLSIDIWTLGEEVDGRRLVVATDISTHSLILHDLIPPPVCRFMKITVIGRYGSTNAR
AKIPLGFYYGHTYILPWESELKLMHDPLRGEGESANQPEIDQHLAMMVALQEDIQCRYNL
ACHRLEALLQSIDLPPLNSANNAQYFLRKPDKAVEEDSRVFSAYQDCIQLQLQLNLAHNA
VQRLKVAIGASRKTLSETSGPEDLIPTSSTEQLRTIVRYLLDTLLSLLHSSNGHSVPAVL
QSTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLCGGERWWGQFLSNVLQELYNSEQLL
IFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPELTMHRRTEGVLDIPMISW
VVMLVSRLLDYVATVEDEAAAAKKPLNGNQWSFINNNLHTQSLNRSSKGGSSLDRLYSRK
IRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQSNKGSSYKLLVEQAKLKQATSKHFKDLI
RLRRTAEWSRSNLDTEVTTTKESPEIEPLPFTLAHDRCISVVQKLVLFLLSMDFTCHADL
LLFVCKVLARIANATRPTIHLCEIVNEPQLERLLLLLVGTDFNRGDISWGGAWAQYSLTC
MLQDILAGELLAPVAAEAMEEGTVSDDVGATAGDSDDSLQQSSVQLLETIDEPLTHEIAG
TPPLSSLEKDKEIDLELLQDLMEADIDPLDIDLEKDPLAAKVFKPISSTWYDYWGADYGT
YNYNPYIGGLGMPVAKPPSNTEKNGSQTVSVSVSQALDARLEVGLEQQAELMLKMMSTLE
ADSILQALTSTPPTFSQSPSGTDDSLLGSLQPANQNSQLIIQLSSVPMLNVCFNKLFSML
QVHHVQLESLLQLWLTLSLNSSSSGNKENGADIFLYNANRIPVISLNQASITSFLTVLAW
YPNTLLRTWCLVLHSLTLMTNMQLNSGSSSSIGAQETTAHLLVSDPNLIHVLVKFLSGTS
PHGTNQHSPQVGPTATQAMQEFLTRLQVHLSSTCPQIFSELLLKLIHILSTERGAFQTGQ
GPLDAQVKLLEFTLEQNFEVVSVSTISAVIESVTFLVHHYITCSDKVMSRSGSDSSVGAR
ACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLLKLVNILVQLPLSSNREYSARVSMTTNT
TDSVSDEEKVSGGKDVNGSNTSIPGSPAYVADLVLANQQIMSQILSALGLCNSSAMAMII
GASGLHLTKHENFHGGLDAISVGDGLFTILTTLSKKASTVHMMLQPILTYMACGYMGRQG
SLATCQLSEPLLWFILRVLDTSDALKAFHDMGGVQLICNNMVTSTRAIVNTARSMVSTIM
KFLDSGPNKAVDSTLKTRILASEPDNAEGIHNFAPLGTITSSSPTAQPAEVLLQATPPHR
RARSAAWSYIFLPEEAWCDLTIHLPSAVLLKEIHIQPHLASLATCPSSVSVEVSADGVNM
LPLSTPVVTSGLTYIKIQLVKAEVASAVCLRLHRPRDASTLGLSQIKLLGLTAFGTTSSA
TVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISDLEGMMASAAAPTANLLQTCAALLMSPY
CGMHSPNIEVVLVKIGLQSTRIGLKLIDILLRNCAASGSDPTDLNSPLLFGRLNGLSSDS
TIDILYQLGTTQDPGTKDRIQALLKWVSDSAKMAALKRSGRMNYMCPSSSAVEYGLLMPS
PSHLHCVAAILWHSYELLVEYDLPALLDRELFELLFNWSMSLPCNVVLKKAVDSLLCSMC
HIHPNYFSLLMGWMGIIPPPVQCHHRLSMTDDSKKQDLSSSLTDDSKNAQAPLALTESHL
ATLASSSQSPEAIKQLLDSGLPSLLVRSLASFCFSHISYSESIAQSIDNSQDKLRRHHVP
QHCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGSEVNPLWTALLFLLCHSGSTAGGHN
LGAQQSSTRSASHSSAATTVLTTQQRTAIENATVAFFLQCISCHPNNQKLMAQVLCELFQ
TAPQRGSLPTSGNISGFVRRLFLQLMLEDEKVTMFLQSPCPLYKGRINATSHVIQHPMFG
AGHKFRTLHLPVSTTLSDVLDRVSDTPSITAKLISEQKDDKEKKNHEEKEKVKADNGFQD
NYSVVVASGLKSQSKRAVSSTPPRPPSRRGRAIPDKIGSTSSSADTANKIITVPVFHLFH
RLLAGQPLP
Download sequence
Identical sequences ENSRNOP00000006830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]