SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007160 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007160
Domain Number 1 Region: 596-868
Classification Level Classification E-value
Superfamily Kelch motif 3.27e-67
Family Kelch motif 0.0000805
Further Details:      
 
Domain Number 2 Region: 306-429
Classification Level Classification E-value
Superfamily POZ domain 1.02e-26
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007160   Gene: ENSRNOG00000005371   Transcript: ENSRNOT00000007160
Sequence length 875
Comment pep:known chromosome:Rnor_5.0:6:40403632:40706610:1 gene:ENSRNOG00000005371 transcript:ENSRNOT00000007160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRHHSRFERDYRVGWDRREWSVNGTHGATSVCSVTSGAGGGTASSLSARPGLLPLPVVP
SRLPTPATAPAPCTTGNSEAITSLVASSASAVTTKAPGISKADNQSQGLTTSIRWGQTPV
NQSTPWDTDEPPSKQMREGDNPGTGPWVTTVAAGNQPSLIAHSYGVAQPPTFSPAVNVQA
PVIGVTPSLPPHVGPQLPLMPGHYSLPQPPSQPLSSVVVNMPAQALYASPQPLAVSTLPG
VGQVARPGPTAVGNGHMAGPLLPPPPPAQPSAALPSSVPATNGPPTTDSAHGLQMLRTIG
VGKYEFTDPGHPKEMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASCSLYFKDLIQR
SVQDGSQGSREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFC
KVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDF
IAYVSNDSLNTKAEELVYETVIKWIKKDPATRAQYAAELLAAVRLPFIHPSYLLNVVDNE
ELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQR
SLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLL
DNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVERYDTITNQWEAVAPLPKAV
HSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNTWSFIESPMIDNKYAPAVTLNGFV
FILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNM
EAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG
Download sequence
Identical sequences D4AEF4
ENSRNOP00000007160 ENSRNOP00000061351 NP_001100183.1.100692 NP_001100183.1.4139 XP_008762772.1.100692 XP_017449560.1.100692 XP_017449561.1.100692 10116.ENSRNOP00000007160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]