SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008999 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008999
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.6e-77
Family BAR domain 0.00000000174
Further Details:      
 
Domain Number 2 Region: 270-333
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008999   Gene: ENSRNOG00000006761   Transcript: ENSRNOT00000008999
Sequence length 338
Comment pep:known chromosome:Rnor_5.0:5:107614520:107653528:1 gene:ENSRNOG00000006761 transcript:ENSRNOT00000008999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTM
SKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDME
VKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESK
EIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRRE
YQPKPRMSLEFATGDGTQPNGGLSHTGTPKPAGVQMDQPCCRALYDFEPENEGELGFKEG
DIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH
Download sequence
Identical sequences ENSRNOP00000059030 ENSRNOP00000008999 10116.ENSRNOP00000008999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]