SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009530 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009530
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000327
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009530   Gene: ENSRNOG00000007258   Transcript: ENSRNOT00000009530
Sequence length 264
Comment pep:novel chromosome:Rnor_5.0:5:2803062:2832814:1 gene:ENSRNOG00000007258 transcript:ENSRNOT00000009530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLWMVLCALARLWPGALAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRLTG
DCCFDYDRACPARPCFVGEWSPWSGCAGQCQPTMRVRRRSVHQEPLNGGAPCPPLEERAG
CLEYSSSQGQDCGHSFVPAFITSSAFNKKRIVQAVSPQWPTHTEDAGYCMEFKTESLTAH
CALDSRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLRWQAIGNPRC
QGTWKKVRRAEQCSCPDVHRFIFI
Download sequence
Identical sequences D3ZS55
XP_001063197.2.4139 XP_216317.4.100692 ENSRNOP00000009530 ENSRNOP00000009530 10116.ENSRNOP00000009530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]