SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009578 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009578
Domain Number 1 Region: 167-181,326-577
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-59
Family Nuclear receptor ligand-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 99-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-29
Family Nuclear receptor 0.0000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009578   Gene: ENSRNOG00000006983   Transcript: ENSRNOT00000009578
Sequence length 590
Comment pep:known chromosome:Rnor_5.0:7:35137598:35189641:1 gene:ENSRNOG00000006983 transcript:ENSRNOT00000009578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHEGSTPGKVFLT
TPDAAGVNQLFFASPDLSTPHLQLLTENSPDQGPNKVFDLCVVCGDKASGRHYGAITCEG
CKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEV
SREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSTGLLDSGMFVNIHPSGIKTE
PALLMTPDKAESCQGDLGTLASVVTSLANLGKAKDLSHCGGDLPVVQSLRNGDTSFGAFH
QDIQTNGDVSRAFDNLAKALTPGENPACQSPGESMEGSTHLIAGEPSCMEREGPLLSDSH
VVFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVKAYWNEL
FTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSPERRKLLMEHIFKLQEFCNSMVKLC
IDGHEYAYLKAIVLFSPDHPGLENMELIEKFQEKAYVEFQDYITRTYPDDTYRLSRLLLR
LPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHSL
Download sequence
Identical sequences Q8VIJ4
NP_665723.1.100692 NP_665723.1.4139 XP_008763438.1.100692 XP_017450160.1.100692 ENSRNOP00000009578 10116.ENSRNOP00000009578 ENSRNOP00000009578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]