SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009683 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009683
Domain Number 1 Region: 18-257
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.7e-50
Family Nuclear receptor ligand-binding domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009683   Gene: ENSRNOG00000007229   Transcript: ENSRNOT00000009683
Sequence length 260
Comment pep:known chromosome:Rnor_5.0:5:155465275:155468590:1 gene:ENSRNOG00000007229 transcript:ENSRNOT00000009683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSQSGVCPCQGSASHPTILYTLLSPGPRTRPMAPASRSHCLCQQHRPVRLCAPHRTCR
EALDVLGKTVAFLRNLPSFCLLPHEDQRRLLEGCWGPLFLLGLAQDTVTFEVAEAPVPSI
LKKILLEEPNSGAQGAQPPDPPQPSLAAVQWLQHCLESFWSLELGPKEYAYLKGTILFNP
DVPGLHASCHIAHLQQEAHWALCEVLEPWYPASQGRLARILLMASTLKNISCTLLVDLFF
RPVIGDVDITELLEDMLLLR
Download sequence
Identical sequences P97947
10116.ENSRNOP00000009683 ENSRNOP00000009683 ENSRNOP00000009683 NP_476474.1.100692 NP_476474.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]