SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010054 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010054
Domain Number 1 Region: 641-836
Classification Level Classification E-value
Superfamily Sec7 domain 5.76e-73
Family Sec7 domain 0.00000185
Further Details:      
 
Domain Number 2 Region: 405-587,1096-1497,1655-1762
Classification Level Classification E-value
Superfamily ARM repeat 4.53e-28
Family Plakophilin 1 helical region 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010054   Gene: ENSRNOG00000007485   Transcript: ENSRNOT00000010054
Sequence length 1791
Comment pep:known chromosome:Rnor_5.0:3:169733008:169814500:1 gene:ENSRNOG00000007485 transcript:ENSRNOT00000010054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAELEKQRLGAAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TVCNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPIQSKPQSPVIQATAGSPKFSRLKQSQAQS
KPTTPEKTELPNGDHARSSLGKVNSENGEAHRERGSSISGRAEPSGGSDNGAQEVVKDIL
EDVVTSAVKEAAEKQGLPEPDQAPGVPECQECTVPPAVDENSQTNGIADDRQSLSSADNL
EPDAQGHPVAARFSHILQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLS
VLQNAGPVFRSHEMFVTAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQ
IEVFFKEIFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERL
VNDLSKIAQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQATLGQ
ERLPDQEMGDGKGLDMARRCSVTSVESTVSSGTQTAIPDDPEQFEVIKQQKEIIEHGIEL
FNKKPKRGIQFLQEQGMLGAAVEDIAQFLHQEERLDSTQVGEFLGDSTRFNKEVMYAYVD
QLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLA
YSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETK
EHTMATKSTKQNVASEKQRRLLYNVEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPM
FKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAVRIACIFGMQLERDAYVQALARFSL
LTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRY
LSGSGREREGSLKGHSLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVVAVD
RIFTGSTRLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSR
IWHVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKK
NRSPTIRDMVIRCIAQMVSSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVS
TIFQHHFPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTS
DDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFAKHWWQD
LFRIVFRIFDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEALHEVLLSDVFAQLQ
WCVKQDNEQLARSGTNCLENLVISNGEKFSPAVWDETCNCMLDIFRTTIPHVLLTWRPAG
MEEEVSDRHLDVDLDRQSLSSIDRNASERGQSQLSNPTDDSWKGAPYANQKLLASLLIKC
VVQLELIQTIDNIVFYPATSKKEDAEHMVAAQQDTLDADIHIETENQGMYKFMSSQHLFK
LLDCLQESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDE
NRRDSWGEIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHAS
VYYPYLCEMMQFDLIPELRAVLRKFFLRIGLVYKIWVPEEPSQVPAASTAW
Download sequence
Identical sequences Q7TSU1
10116.ENSRNOP00000010054 ENSRNOP00000010054 ENSRNOP00000010054 NP_851597.2.100692 NP_851597.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]