SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010126 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010126
Domain Number 1 Region: 623-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000458
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 660-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000184
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 137-167
Classification Level Classification E-value
Superfamily SET domain 0.00000903
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 179-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000867
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010126   Gene: ENSRNOG00000007683   Transcript: ENSRNOT00000010126
Sequence length 757
Comment pep:novel chromosome:Rnor_5.0:5:40480622:40488351:-1 gene:ENSRNOG00000007683 transcript:ENSRNOT00000010126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARVTQRTEDARRAADSSSQGCSWFCHLRPVEDPVSPSVCLAAVATMHGTSRTSATSVN
ADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDESGGSPLEWIGLIRA
ARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEKG
EERYICWYCWRTFRYPNSLKAHLRFHCVLSGGGGRAFLPQEHAARPGASPVAEGLGLPPK
PTAPDLTAPVQAAALRPQAQAAQLSQACGTRESIKREASLAPLASSPPPGKWGTPKKGKE
QPDRAHSHFLGIVGGSSAGSAGLPFYPGVRSAFKPAGLARAAAQSDPYREEGGGKGPGLG
LGRLLGGGRAAGRPGSGESPAGHHHHHHHAHHHHHHHPKCLLAGEPPPAGLPCPGALRAF
PLLAGHPEEASAFKHVERAPPAAATAASLPAARYAALPAPGLPVERCALPPLDAGSLKAY
PGGDPGGECSPLPAVMPAFTVYSGDLLYGPPATYYPLKLHLGGLLKYPESISYLSGPAAA
AAAAAAAAAAAAAIGPTELGSLASIDREIAMHTQQLSEMAAGKGRTRLDSGTLPPAVVAA
AGPGGGGGGGGGGGAAGKAKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPF
GDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLIAKAGDGSGAEP
GYALEPGDPKSEDSDVDVCFTDDQSDPEAGGRGEHDS
Download sequence
Identical sequences D3ZKY4
ENSRNOP00000010126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]