SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010293 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010293
Domain Number 1 Region: 306-408
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 2 Region: 44-149
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 417-531
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0027
Further Details:      
 
Domain Number 4 Region: 186-283
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010293   Gene: ENSRNOG00000007638   Transcript: ENSRNOT00000010293
Sequence length 754
Comment pep:known chromosome:Rnor_5.0:4:178552500:178568813:1 gene:ENSRNOG00000007638 transcript:ENSRNOT00000010293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVNVCYCCPWRLLLLHFLCSSSMGSPSPSTDPEKKVGSQGLRFRLAGFPRKPYEGRVE
IQRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCKGTEG
SVTECASRGWGNSDCTHDEDAGVICKDQRLPGFSDSNVIEVDHQLQVEEVRLRPAVEWGR
RPLPVTEGLVEVRLPEGWSQVCDKGWSAHNSHVVCGMLGFPGEKRVNMAFYRMLAQKKQH
SFGLHSVACVGTEAHLSLCSLEFYRANDTTRCAGGSPAVVSCMLGPLYATSTGQKKQQHS
KPQGEASVRLKGGAHPGEGRVEVLKAGTWGTVCDRKWDLQAASVVCRELGFGTAREALSG
ARMGQGMGAIHLSEVRCSGQEPSLWKCPSKNITAEDCSHSQDAAVRCNLPYTGVETKIRL
SGGRSRYEGRVEVQIGVPGHLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDS
GNVTEVVMSGVRCTGSELSLNQCAHHNTHVTCKRTGTRFTAGVICSETASDLLLHSALVQ
ETAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRH
SWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGE
QGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDG
HRIWVHNCHIGDAFSEEANRRFERYPGQTSNQIV
Download sequence
Identical sequences D3ZP82
NP_001101336.1.100692 NP_001101336.1.4139 ENSRNOP00000010293 10116.ENSRNOP00000010293 ENSRNOP00000062815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]