SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010325 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010325
Domain Number 1 Region: 760-853
Classification Level Classification E-value
Superfamily Immunoglobulin 2.29e-23
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 1048-1142
Classification Level Classification E-value
Superfamily Immunoglobulin 9.83e-23
Family I set domains 0.007
Further Details:      
 
Domain Number 3 Region: 952-1046
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-20
Family I set domains 0.0034
Further Details:      
 
Domain Number 4 Region: 856-950
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 120-214
Classification Level Classification E-value
Superfamily Immunoglobulin 2.18e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 1144-1231
Classification Level Classification E-value
Superfamily Immunoglobulin 6.87e-19
Family I set domains 0.0062
Further Details:      
 
Domain Number 7 Region: 311-405
Classification Level Classification E-value
Superfamily Immunoglobulin 5.39e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 215-309
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-16
Family I set domains 0.0093
Further Details:      
 
Domain Number 9 Region: 27-116
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-16
Family I set domains 0.0067
Further Details:      
 
Domain Number 10 Region: 404-487
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000135
Family I set domains 0.018
Further Details:      
 
Domain Number 11 Region: 573-664
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000151
Family I set domains 0.0042
Further Details:      
 
Domain Number 12 Region: 667-757
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000011
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010325   Gene: ENSRNOG00000007600   Transcript: ENSRNOT00000010325
Sequence length 1320
Comment pep:known chromosome:Rnor_5.0:X:136852224:136867466:-1 gene:ENSRNOG00000007600 transcript:ENSRNOT00000010325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLRTFTLLLLCIWLNRGMTSMAAVESQPELWIESNYPQAPWENITLWCKSPSRVSSKFL
LLKDNTQMTWIHPPYKTFQVSFFIGALTESNTGLYRCCYWNEKGWSKPSKILELEAPGQL
PKPIFWIQAETPPFPGCNVNILCHGWLQDLVFMLFKEGYTEPIDYQVPTGTMAIFSIDNL
APENEGIYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPILAPGESLSLRCQ
GPIYGMTFALMRLEDLKKPYYYKKPIKNEAYFYFQALKTQDTGHYLCFYYDGSYRGSLLS
DILKIWVTDTFPKTWLLVQPSPVIQMGQNVSLRCGGLMDGVGLALHKKGEEKPLQFLDAT
SNTGNNSFFLKNVTYRDAGIYSCHYYLTWKTSIKMATYNTVELIVVAWPSSVFKVGKTIT
LQCRVSHPVLEFSLEWEETTTFQKFSVDGDFIITNIEGQGTGTYSCSYRIESHANIWSHR
SEPLKLVGPAVTGFLPWNSILNEAIRVSLTVQFLSLLLLVLWLQWKCRRLRLREAWLLGT
AQGVAMLVILIALLCCGLCNGALTEEIEIIMPTPKPELWAETNFPQAPWKNVTLWCRSPS
GSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVSEPSEALE
LVGTDILPKPVISASLPIRGQELQIRCKGWLEGLGFALYKMGEQEPVQQLGAVGREAFFT
IQRMEDKEEGNYSCRTHTEKQPFKWSEPSAPLELVIKELYPKPFFKTWASPVVTPGSRVT
FNCSTSREHMSFILYKDGNEIASSDPVWGNPGTSTAHFLIISVGIGDGGNYSCRYYDFSI
WSEPSDPVELIVTEFYPKPTLLAQPGPVVLPGKNVTLRCQGIFQGMRFALLQEGAHAPLQ
FQSASGTSVDFLLHTVGAEDFGNYSCVYYETTMSNRGSYLSTPLMIWVTDTFPRPWLSAE
PSSVVTMGQNVTLWCQGPVHGVGYILHKEGEATSMQLWDSTSNEGAFPIINISGASIGRY
SCCYHPDWMSPIKIQPSNTLELIVTGLLPKPSLLVQPGPMVVPGENMTFQCQGELPDSTF
VLLKEGTQQPIEQQRPSGYRADFWMPVVRDQDSGVYSCVYYLDSAPLVASNHSNSLEIWV
TDKPPKPSLSAWPSTVFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQFSEDGDFVIGNM
EGKGIGNYSCSYRLQAYPDIWSEPSDSLELVGAAGPVAQECTVGNIVRSTLIVVVVVALG
IVLAIEWKKWPRLRTRGSETDGRDQTIVLEECNQDGEPGTATNSPSSALQGVSVEQTVPI
Download sequence
Identical sequences Q925N6
ENSRNOP00000010325 ENSRNOP00000010325 10116.ENSRNOP00000010325 NYSGRC-IgSF-ENSRNOP00000010325 NP_786939.1.100692 NP_786939.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]