SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011601 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011601
Domain Number 1 Region: 124-418
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-90
Family Nuclear receptor ligand-binding domain 0.00000000064
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-28
Family Nuclear receptor 0.00000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011601   Gene: ENSRNOG00000008574   Transcript: ENSRNOT00000011601
Sequence length 423
Comment pep:known chromosome:Rnor_5.0:7:139536241:139585928:-1 gene:ENSRNOG00000008574 transcript:ENSRNOT00000011601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSL
RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRVDGSTGSYSPRPTLSFSGNSSS
SSSDLYTTSLDMMEPSGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGF
AKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAG
HTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQ
TYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
EIS
Download sequence
Identical sequences G3V744
ENSRNOP00000011601 ENSRNOP00000011601 10116.ENSRNOP00000011601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]