SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011890 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011890
Domain Number 1 Region: 88-335
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.1e-69
Family Nuclear receptor ligand-binding domain 0.00000000205
Further Details:      
 
Domain Number 2 Region: 20-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011890   Gene: ENSRNOG00000008971   Transcript: ENSRNOT00000011890
Sequence length 418
Comment pep:known chromosome:Rnor_5.0:2:119962231:120107977:-1 gene:ENSRNOG00000008971 transcript:ENSRNOT00000011890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSAPETTSMNTTDSGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRF
SRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGTNIPSINTLAQA
EVRSCQISVPNPSASTDINVKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVA
LLRAHAGEHLLLGATKRSMMYKDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEI
QIDDNEYACLKAIVFFDPDAKGLSDPGKIKNMRFQVQISLEDYINDRQYDSRGRFGELLL
LLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLGGAANDGGHPHHPMHPHLSQDPLT
GQTILLGPMSTLVHTDQIATPETPLPSPPQGSGQEQYKITANQASVISHQPLSKQKQL
Download sequence
Identical sequences F1M342
NP_001102409.1.100692 NP_001102409.1.4139 ENSRNOP00000011890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]