SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012537 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012537
Domain Number 1 Region: 417-611
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-69
Family Nuclear receptor ligand-binding domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 129-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-29
Family Nuclear receptor 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012537   Gene: ENSRNOG00000009329   Transcript: ENSRNOT00000012537
Sequence length 614
Comment pep:known chromosome:Rnor_5.0:10:86479868:86486598:-1 gene:ENSRNOG00000009329 transcript:ENSRNOT00000012537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGTVPPSLSDDSSPSSASSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKGTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQNAMNLANNQLSSLCPLETS
PAPHPTSGSVGPSPPPAPAPTPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGTSPGNFNANHASGSPPATTPQCWESQGCPSTPNDNNLLAAQRHNEALNGLRQ
GPSSYPPTWPSGPAHHSCHQPNSNGHRLCPTHVYSAPEGKAPANGLRQGNTKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ
Download sequence
Identical sequences G3V770
10116.ENSRNOP00000012537 ENSRNOP00000012537 ENSRNOP00000012537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]