SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012600 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012600
Domain Number 1 Region: 902-1082
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.8e-39
Family Ypt/Rab-GAP domain of gyp1p 0.005
Further Details:      
 
Domain Number 2 Region: 1057-1178
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.57e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 191-221,321-450
Classification Level Classification E-value
Superfamily PH domain-like 8.1e-30
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 31-185
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-23
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000012600
Domain Number - Region: 445-506
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0615
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012600   Gene: ENSRNOG00000009431   Transcript: ENSRNOT00000012600
Sequence length 1308
Comment pep:known chromosome:Rnor_5.0:15:89697677:89871384:-1 gene:ENSRNOG00000009431 transcript:ENSRNOT00000012600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPSCIQDEPFPHPLEPEPIALAQPGATKPGDKRFRLWYVGGSCLDRRTTLPMLPWLMA
EIRRRSLKPEAGGCGAPAAREVLLVLSAPFLRCVPAPGVGVGGGAGSGAVQPNTGVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPNQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGRVIVTHKKAPSSLIDDCKDKFSLHEQQRLKLQ
GERGGDPGDGDEMGVLEAESPVSPDDGLPEKPDGLVNCPRALPSLASLPALASQPALASS
RVCFPERILEDCGFDEQQEFRSRCSSVTGVMQKKVPSNNQKTQPRRRHASAPSHVQPSDS
EKNRTMLFQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESLEPGLS
QYICYVFQCANESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGL
YPPRAKLVIQRHLSSLTDNEQADIFERVQKMKPISDQEENELVILHLRQLCEAKQKTHVH
IGEGQAIISNSTIPENSTSGGRFKLDVLKNKAKRSLTSSLENIFSRGANRMRGRLGSVDS
FERSNSLASEKDFSPGGSPPTPPASPLSSAWHTFPEEDSDSPQFRRRAHTFSHPPSSSRR
KLNLQDGKAHGLRSPLLRQNSSEQCSVLPSARRMCKESNSSSSLPSLHTSFSAPSFTASS
FLKSFYQSSGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLSAGGTPVTPRRISW
RQRIFLRVASPVNKSPSAMQQQKDGLDRTELLPLSPLSPTMEEEPLVIFLSGDEDTEKVE
EKKKSKEIKSLWKKAIHQQILLLRMEKENQKLEEARRDELQSRKVKLDYEEVGTCQKEVL
IAWDKKLLNCRTKIRCDMEDIHTSLKEGVPKSRRGEIWQFLALQYRLRHRLPNKHQPPDT
SYKELLKQLTAQQHAILVDLGRTFPTQPYFSVQLGAGQLSLFNLLKAYSLLDKEVGYCQG
ISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLY
NHLEENEISPSLYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSSQEAL
VMECENFENIVEFLKSTLPDMNTTEMEKIITQVFEMDISKQLHAYEVEYHVLQDELLESS
YACEDNESLEKLERANNQLKRQNMDLLEKLQVAHAKIQALESNLETLLTRETKMKALIRT
LEQDKMAYQKTVEQIRKLLPADALANCELLLKDLSYPTNDKAKAGNKP
Download sequence
Identical sequences ENSRNOP00000012600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]