SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013172 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013172
Domain Number 1 Region: 822-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000162
Family Laminin-type module 0.0006
Further Details:      
 
Domain Number 2 Region: 280-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000026
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 928-978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 878-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.001
Further Details:      
 
Domain Number 5 Region: 336-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 6 Region: 719-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 439-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 392-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 9 Region: 767-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000963
Family Laminin-type module 0.00053
Further Details:      
 
Domain Number 10 Region: 976-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000013172
Domain Number - Region: 95-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000527
Family Galactose-binding domain 0.086
Further Details:      
 
Domain Number - Region: 680-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0273
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013172   Gene: ENSRNOG00000009769   Transcript: ENSRNOT00000013172
Sequence length 1580
Comment pep:known chromosome:Rnor_5.0:3:14627439:14686842:-1 gene:ENSRNOG00000009769 transcript:ENSRNOT00000013172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSGILSRLATVVCVALVMLKAHCATGAGMGSCYDGAGRAQRCLPEFENAAFGRRAEAS
HTCGQPPEDFCPHVGAPGAGPQCQRCDDADPRRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLHLGKAYEITYVRLKFHTSRPESFAIYKRTHTGGPWEPYQYYSASCQKTY
GHPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDLLISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASACGPNEAGQLACH
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTAGPHCEHCEKNYYRWDPKTPCQPCDCHPAGSLSLQCDNSGTCPCKLTVTGWK
CDRCLPGFHSLSEGGCRPCTCNVAGSLGTCDPRSGNCPCKENVEGGLCDRCRPGTFNLQP
HNPAGCSSCFCYGHSKVCAPASGFQEHHIRSDFRHGADGWQARSTEVSERPLQWSQSGIL
LGLRGGEELSAPEKFLGDQRLSYGQPLILTLQVPPGGSPPPMQLRLEGAGLSLALKPSNL
PSSQDTRQPGRVQLQFLLQETSEEAEPPLPAFHFQRLLSNLTTLSIWTSGQGLGHSGHVL
LCEVHLTSARPQRGLAPPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYTNCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGHADDCQPCPCPGQSACTTIPE
SRDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSRNVDLNAVGNCDPHS
GRCLRCLHNTTGAHCEHCQEGFYGSALATRPADKCAPCSCDPRGSSSQKTCNPATGQCAC
LPYVTGRDCSRCSPGFYDLQPGRGCQSCKCHPVGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASPQCHENSTCVCRPGFVGYKCDRCQDNFFLVDGDTG
CQECPTCYALVKEEAAKLKTRLMLMEGWLQGSECGSPWGPLDILQGEAPRGDVYQGHHLF
QDPTGLFSHVPNPTVMTLTLTWVSVPCLLPCTDCTQPYGERHCLQRANLGHCTYHKQGPC
SESAAVMFFQANLQEGSSAPTNWGRLASEAYILTRSHRDTATKIEATVERALLASNTSYE
LLWKLLKGSVASEAQQELEERYQEVQAAQTALGIAVAEALPKAEKALATVKQVVGAAAPR
LGSMVTPEAMDSQARYLGRRVKALEQKLQQNQAGQAVGALQVEAGRALRKVEPFLQLRNK
TTAALTQVSSAVQAAKVTVIGAKTLLADLEGMKLRFPLPKEQAALKRKAGSIRTRLLKDT
KRKTKQAERMLGNAASLSSNSQKRSKEAELMSKENAKLARAFLREGKQNYRHASRLASQT
QATLRQASRLVLTSEARKQELEEAKQVASGLSTVERQIRESRISLEKDTKVLSELLAKLG
SLGTHQAPAQTLNETQQALESLRLQLDSHGSLHHKLRQLEEESARQELQIQSFENDLAEI
RADKHNLETILSSLPENCAS
Download sequence
Identical sequences ENSRNOP00000013172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]