SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014560 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014560
Domain Number 1 Region: 235-322,527-564
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.09e-44
Family Inhibitor of apoptosis (IAP) repeat 0.00000322
Further Details:      
 
Domain Number 2 Region: 147-224
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.4e-33
Family Inhibitor of apoptosis (IAP) repeat 0.0000787
Further Details:      
 
Domain Number 3 Region: 18-114
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.16e-29
Family Inhibitor of apoptosis (IAP) repeat 0.00031
Further Details:      
 
Domain Number 4 Region: 427-522
Classification Level Classification E-value
Superfamily DEATH domain 1.13e-21
Family Caspase recruitment domain, CARD 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014560   Gene: ENSRNOG00000010602   Transcript: ENSRNOT00000014560
Sequence length 589
Comment pep:known chromosome:Rnor_5.0:8:6015753:6033822:-1 gene:ENSRNOG00000010602 transcript:ENSRNOT00000014560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSTVLSNWTKENKEKMKYDFSCELYRMSTYSAFPRGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKQGDSPTEKHRQFYPSCSFVQTLLSGGLQSAAKNTSPAKSRFAHSLPL
EQGGIHSSLPSNPLNSRAVEDFSLRMNPCSYAMSTEEARFLSYSMWPLSFLSPAELAKAG
FYYTGPGDRVACFACGGKLSNWEPNDDPLSEHRRHFPHCPFLENTSETQRFSVSNLSMQT
HSARMRTFLYWPSSVLVQPEQLASAGFYYVDHNDDVKCFCCDGGLRCWEPGDDPWIEHAK
WFPRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDTSEEENADPPVVHLGPGENWEDAV
MMNTPVVKAALDMGFSRSLVRQTVQRQILATGENYRTVSDIVSALLNAEDERREEEKERQ
SEETASGDLSLIRKNRMALFQQLTCVIPILDDLLEASVLTKEEHDIIRQKTQIPLQAREL
IDTILVKGNAAASVFKNSLKEVDSTLYEHLFVEKTMKYIPTEDVSGLSLEEQLRRLQEER
TCKVCMDREVSIVFIPCGHLVVCRECAPSLRKCPICRGTIKGTVRTFLS
Download sequence
Identical sequences Q6P6S1
ENSRNOP00000014560 NP_068520.2.100692 NP_068520.2.4139 XP_006242556.1.100692 XP_006242557.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]