SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019654 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019654
Domain Number 1 Region: 222-374
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.26e-25
Family DnaQ-like 3'-5' exonuclease 0.0015
Further Details:      
 
Domain Number 2 Region: 487-647
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.17e-18
Family Canonical RBD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019654   Gene: ENSRNOG00000014513   Transcript: ENSRNOT00000019654
Sequence length 754
Comment pep:known chromosome:Rnor_5.0:1:196484323:196554085:1 gene:ENSRNOG00000014513 transcript:ENSRNOT00000019654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEEEENPRKRKETPNSALTTELDRPSWDVQDPEPQAKKARLSTILFTDNCEVTHRQLC
ELLKYAILGKSTLPKPSWCQLLHQKQLNNVVVFILKGMSQLHFYRFYLEFRFLRKTFRHK
FSLPPPTSSFLFDIIGLQKKKSARGCPRTVEGPLISATLKSSIDLQNDPIIQKYGYKNVS
LTRCLLTKEEMKTFHFPLQGSPNCENFILLKYSGFITDSSPLFGLDCEVCLTSMGKELTR
ISLVAEGGYCLMDELVKPDFKILDYLTSFSGITKEILNPVTTKLKDVQKLLRELLPPDAV
LVGHCLDLDLRVLKIIHPYVIDTSLLYIGKQGRRFKLTFLAKVILGKDIQCPNKLGHDGI
EDARTALELVQYFLKYGPKKIAEFNLEALAANQEQGNKEGATHMRSVLECLDSMGQKLLF
LTQDIDELSSYRNCQTVKCSSNKEVLEQARVEVPLFPFNIVQFSFRPFPPLFAEEMKNNM
KTRWTEMSTIYAGPFSKDCNVGSLKKVFSSLGPVQSITLVLETYRPYFSIQYELLEAAQL
AIETMNGTILEGSCIRVHRLLTELTLECDTLVRELEQDSENQGTIYVAGIGETFKEHLLE
QSNLFPDLEAVILPKELKSRKQKNYCFLKFKTFNSAQVALEVLKGKDWKLKGRNALTSRH
LQAWLKNIHPEPSMPMGLRIVPPLLERHIFRTLKANHPKIVAWRWSRRIEKLYHSLSPGT
FCLILLPGTKNTFGSHPGLGLMKIKEEEGGDTLL
Download sequence
Identical sequences A1A5R7
NP_001073174.1.100692 NP_001073174.1.4139 ENSRNOP00000019654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]