SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020873 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020873
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000488
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 704-759
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000164
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 473-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000258
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 4 Region: 522-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000344
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 612-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000107
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 767-791
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000029
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 7 Region: 566-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000441
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000020873
Domain Number - Region: 139-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0183
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020873   Gene: ENSRNOG00000015558   Transcript: ENSRNOT00000020873
Sequence length 875
Comment pep:known chromosome:Rnor_5.0:3:180788171:180798662:-1 gene:ENSRNOG00000015558 transcript:ENSRNOT00000020873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESFCVGGGRRLQGSSKSGPGKGGSRKEVQLPLLQDPPKLGMPVVHSGHTVPSQAPLCF
DPGNSASDKTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSI
YGLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDHPLPAPKPGPVSRP
VTINRPVGVSKPIGVSKPVTVGKPVGVSKPIGISKPVTVSRPIPVTKPVTVSRPMQVSRP
VPVTKPIPITKPVPLTKHMPVTKLVTVSKPVPLTKPVPVSRPIVVSKPVPVSRPIAISRH
TPPCKMVLLSKSENKTLRATGKNSNKKRAADSLDTCPILPKQARQENGEYGPSTVDQSVT
FQLSTDPSNSSLLPGSRPLMGKEALRPIGPVSQPEEDPERTKHRRKQKTPKKFTGEQPSI
SGTFGLKGLAKAEDKARVHRSKKQEGSGSEEVRKKVLATPVTVSKEAPTPVAHPAPGGPE
EQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCHKLQEALKCQHCRKQFKSKAGLNY
HTMAEHSAKPTDAEASEGGEQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRR
CGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTAPPPEEPTDKIPEAEDLLGVERT
PSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETARLNYTRPGLPTLNPQLL
EAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHFASCSKGDHLVGKYRCLLCPKEFSSES
GVKYHILKTHGENWFRTSADPPSKHKSQDSLMPRKEKKKSLSGGKKRGRKPKERSSEEPA
SKLPPNRDDWPPGGRDRGARSSTGKKAGAGKAPEK
Download sequence
Identical sequences D3ZJ29
ENSRNOP00000020873 NP_001101279.1.100692 NP_001101279.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]