SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022967 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022967
Domain Number 1 Region: 78-129
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000235
Family TNF receptor-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022967   Gene: ENSRNOG00000016782   Transcript: ENSRNOT00000022968
Sequence length 491
Comment pep:known chromosome:Rnor_5.0:5:166864888:166910610:-1 gene:ENSRNOG00000016782 transcript:ENSRNOT00000022968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILLKAAGLLFLGMLQAFPKDRPLDTTCTGDLSYYPGEAARNCCYQCPSGLSPTQPCPQ
GPTARSSVILTTTNEDRKCTACVTCLPGLVEKAPCSGNSPRICECQPGMYCSTPAVNSCA
RCSEKTVVKFPDTAEKNTICDLPSPGSGPNGSNPDDCKTLTSHTTPQAIPTLESPANDSV
RSLLPKQVTDFVNEGATKLVKVPESSSSKASMPSPDPGNAEMNMTLKLPPPGTVPDISTS
ENSMEPASTASTLSLLVDARTSSRMQPTSPLSTGTPFLDPGSMLFWVAMVVLLVGSASFL
LCYWKACRRRFQRKFHLNYLQQTFQPKMEQVDSCPTEKLTQLQRSGSVTDSSAGHTLSPL
SPPAVETGASVGTACLETLPLLDDSITGNSFAPREPPEPRVSTEHTNNRIEKIYIMKADT
VIVGSVKTEVPEGRAPVGSTESELEAELEVDHTPHYPEQETEPPLGSCTEVMFSVEEGGK
EDHEPTTVSEK
Download sequence
Identical sequences ENSRNOP00000022967 ENSRNOP00000022967 10116.ENSRNOP00000022967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]