SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023089 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023089
Domain Number 1 Region: 185-423
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.97e-49
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 32-140
Classification Level Classification E-value
Superfamily POZ domain 3.92e-24
Family Tetramerization domain of potassium channels 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023089   Gene: ENSRNOG00000017189   Transcript: ENSRNOT00000023089
Sequence length 480
Comment pep:known chromosome:Rnor_5.0:18:71933314:71999524:1 gene:ENSRNOG00000017189 transcript:ENSRNOT00000023089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLPGHPEVPGAEPGSAVRGGRGGRGARARHVIINVGGCRVRLAWAALARCPLARLERL
RACRGHDELLRVCDDYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELA
YWGIDEARLERCCLRRLRRREEEAAEARATPPARGPQTSPGRALGSGRLERGRRRLRDVV
ENPHSGLAGKLFAYVSVAFVAVTAVGLCLSTMPDVRAEEERGECSTKCRNLFVLETVCVA
WFSFEFLLRSLQAESKCAFLRTPLAIIDILAILPFYVSLLAGLAAGPTGSKMLERAGLVL
RLLRALRVLYVMRLARHSLGLRSLGLTVRRCAREFGLLLLFLCVAMALFAPLVHLAEREL
GAHRDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHT
FSRSYSELKEQQQRAASPEPVLREDSTRDDSTRSASATEDSSQDPETAGAAGSLPGPVGP
Download sequence
Identical sequences Q9QYU3
ENSRNOP00000023089 NP_001100842.1.100692 NP_001100842.1.4139 XP_006255009.1.100692 XP_006255010.1.100692 XP_006255012.1.100692 XP_008770358.1.100692 XP_008770359.1.100692 XP_017456433.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]