SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023708 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023708
Domain Number 1 Region: 79-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 238-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000361
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 136-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000761
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000023708
Domain Number - Region: 274-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00223
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 195-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023708   Gene: ENSRNOG00000017550   Transcript: ENSRNOT00000023708
Sequence length 440
Comment pep:known chromosome:Rnor_5.0:3:128571581:128604148:-1 gene:ENSRNOG00000017550 transcript:ENSRNOT00000023708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGSQRTLVLLLLLLASPGARAFQSCLNKQQLLTTVRQLQQLLKGQETRFTEGIRNMKS
RLTALQNTVSKMTPDAPPVSCPALDAPPNGKKFGSKYLVDHEVHFTCNPGFQLVGPSSVV
CLANGTWTGEQPRCRDTSECSSQPCHNGGTCVEGVHHYRCICPPGKTGNRCQHQTQAAAA
PGGVAGDSAYSRAPRCAQVEREQHCSCEAGFHLSGTAGGHSVCQDVNECEIYGQEGRPRL
CMHACVNTPGSYRCTCPSGYRILADGKSCEDVDECAGPQHMCPRGTTCINTGGGFQCVNP
ECPEGSGNISYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMAT
ASVPGHPGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILIQTLEGPQTLEVEVDMSEYLE
RSFQASHVSKVTIFVSRYDF
Download sequence
Identical sequences D3ZSY7
ENSRNOP00000023708 10116.ENSRNOP00000023708 ENSRNOP00000023708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]