SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024266 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024266
Domain Number 1 Region: 1192-1296,1370-1526
Classification Level Classification E-value
Superfamily Cullin homology domain 2.7e-36
Family Cullin homology domain 0.0021
Further Details:      
 
Domain Number 2 Region: 791-947
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-33
Family APC10-like 0.0066
Further Details:      
 
Domain Number 3 Region: 349-422
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.72e-31
Family CPH domain 0.0000144
Further Details:      
 
Domain Number 4 Region: 157-204,493-542,615-742
Classification Level Classification E-value
Superfamily ARM repeat 0.000000277
Family RPA1889-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024266   Gene: ENSRNOG00000017857   Transcript: ENSRNOT00000024266
Sequence length 1692
Comment pep:known chromosome:Rnor_5.0:9:15536182:15548930:-1 gene:ENSRNOG00000017857 transcript:ENSRNOT00000024266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHNGHPEYQIRWLILRRGDDGDSSQVDCKA
EHILLWMTDDEIYANCHKMLGEDGQVIRPSQESAEAGALDKSVLGEMETDVKSLIQRALR
QLEECVGAVPPAPLLHTVHVLSAYASIEPLTGVFKDRRVLDLVMHMLSSPDYQIRWSAGR
MIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLTEHPMSFEGVQLP
QVPGRLLFSLVKRYLCVTFLLDRLNGNAEDQDAQNNFIPEELNAGRGRVELEFSMAMGTL
ISELVQAMRWDWASSRSESSSPIFQPPPTEFFRPRAQRFRRSRRFRPRTAFASVNTYALY
VRDTLRPGMRVRMLEDFEEISAGDEGQFRQSNDGMPPVQVLWDSTGHTYWVHWHMLEILG
FEEDIEDVVDIDDQGAMVHGGLGVAPPFQHWKPIAQLFAEPYVVPEEEDREEREHLTQAE
WWELFFFIKKLNAEERQHVVELLQEFLEGEHVLDFEILPELTVPVELAQDLMLSLPQQLD
DSALRDLFNCYVYRKYGPEVLVGKRNRPFVLDDQLNLFRIETDSEAQDPPSQSASPALRQ
LVEGLGPSGKLLVDLERALSSEAPQENEVKPCLLQLQEEPQPFLTLMRSLDTPASNKALH
LTALRILMQLVNFPEALLLPWHEAMDACMTCLRSPNTDREVLQELIFFLHRLTSTSRDYA
VILNQLGARDAISKVLEKHRGKLELAQELRDMVFKCEKHAHLYRKLTTNILGGCIQMVLG
QIEDHRRTHRPIQIPFFDVFLRYLCQGSSAEVKKNKYWEKVEVSSNPHRASRLTDRNAKT
YWESNGTAGSHFITVHMRPGVLIRQLTLLVAGEDSSYMPAWVVVCGGDSISSVNTELNAV
NVMPHASRVILLENLTRFWPIVQIRIKRCQQGGINTRIRGLEVLGPKPTFWPVFREQLCR
HTRLFYMVRAQAWSQDIAEDRRSLLHLSSRLNGALRQEQNFADRFLPDEEAALALSKTCW
EALVSPLVQNITSPDEDSTSSLGWLLNQYLECREAAYNPQSRAAAFSSRVRHLTHLLVHV
EPCEAAPPVVAISQSKGRNRSHDWSSLTTRGLPSSIMRNLTRCWRSVVEEQVNKFLTSSW
KDDDFVPRYCERYYILQKSSSELFGPRAAFLLAMRNGCADALLRLPFLRAAHVSEQFARH
IDQRIQGSRMGGARGMEMLAQLQRCLESVLILSPLEIATTFEHYYQHYMADRLLSVGSSW
LEGAVLEQIGPCFPGRLPQQMLQTLNISEELQRRFHVYQLQQLDQELLKLEDTEKKIQVA
HEDSGKEHKSKKEDAAGETAAVAMADEEEEEGKKEEGEEEEGEGEEELEEEEERYYEGTM
PEVCVLVLSPRFWPVASVCHMLNPTTCLPSYLRGTINHYSNFYSKSQSHSGLEKESPRQL
QWTWQGRAEVQFGDQILHVSTVQMWLLLHLNHLKAVSVESLQALSELPPEVLNKAIGPLT
SSRGPLDLQEQKNIPGGVLKIRDDSEEPRPRRGNVWLIPPQTYLKAEDEEGRNLEKRRNL
LNCLVVRILKAHGDEGLHIDQLVHLVLEAWEKGPCPPRGLVSSLGRGAACRSSDVLSCIL
HLLGKGTLRRHDDRPQMLFYAVPITVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYA
SCTGTQTFSTFR
Download sequence
Identical sequences D3ZEF4
10116.ENSRNOP00000024266 ENSRNOP00000024266 ENSRNOP00000024266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]