SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024645 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024645
Domain Number 1 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 623-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 512-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-19
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 45-90
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 665-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000107
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000347
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 10 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000165
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024645   Gene: ENSRNOG00000033729   Transcript: ENSRNOT00000024645
Sequence length 726
Comment pep:known_by_projection chromosome:Rnor_5.0:1:100574928:100581740:1 gene:ENSRNOG00000033729 transcript:ENSRNOT00000024645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTYLQNPEEVRDRPRLETTEDMPTDMNFCQMPQRLGAEEQDGPCERLVSFDDVTVDFSQ
EEWQHLDSAQRCLYQEVMLEIYSHLLAVGKLQLDIQHQQIFVKASFLTDATNEVTRHGSC
CSVLEKLWQDDDTAAKRDQQSQVRPISPDAFRNQKLLNIDSVCDYEETGEPHLISTQYVP
PRANSDNQSNTIEQLNDIIGSHQCFTQGSSNDICTVPPQREKSYNESQFGNILSPNLPLM
DHEINFQDKPVGYTGCGKVFTGEVVFCEQQITNNMETSFICHTCGKTFLHKSKLASHSET
HREETPYECPDCAKSRRGKSSLQVLCGIQTKEKPYECHVCGKSFSYTSHLKVHLRTHTGE
KPYACSDCGKAFSQKSVLTIHQRIHTGEKPYTCSDCGKMFVCASDLTKHCRFHTGEKPYE
CPDCGKSFSIKSNLLAHHRIHTSEGPYKCFDCGESFRKISQLKVHHQIHTDGRSFVCSDC
GMAFSQKSVLTTHQRIHSGDKCYPCNDCGKLFLYASDLKKHCRFHTGEKPYKCHDCGKSY
SVKSHLHVHHRIHTGERPYKCDDCGKSFRRNSHLQMHQQTHTGEKPYKCSDCGKSFRRAS
HLKVHHRIHTGEKPYVCSECGKAFNDRSVLSTHQRIHTGEKPYICSDCGKAMSSKANLKE
HQRIHTGEKPYVCAECGKAFSDKSSFYRHCKIHSRDKPFVHNKGEKGFLQNSQVTSYEQT
QSAEKL
Download sequence
Identical sequences F1MAM5
10116.ENSRNOP00000024645 ENSRNOP00000024645 ENSRNOP00000024645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]