SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026378 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026378
Domain Number 1 Region: 541-711
Classification Level Classification E-value
Superfamily Sec7 domain 1.96e-55
Family Sec7 domain 0.0000442
Further Details:      
 
Domain Number 2 Region: 749-870
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-26
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026378   Gene: ENSRNOG00000019435   Transcript: ENSRNOT00000026378
Sequence length 1023
Comment pep:known chromosome:Rnor_5.0:1:273490272:273505122:-1 gene:ENSRNOG00000019435 transcript:ENSRNOT00000026378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLIRRVVGPGPRGRDL
GRVTAPCTPLRAPPSPHIAPSPWGPSSPTGKPPPGAQSSVVIFRFVEKASVRPLNGLPAS
GGLSRSWDLGGISPSRPTPALGPGCNRKLRLEASTSDPLPAGGGSVLPGSRDPSRGPLIP
PQIGADGLYSSLPNGLGGTPEHLVMHFRGPADTGFLNQGDTWSSREVSSHAQRIARAKWE
FFYGSLDPPSSGAKPPEQALPSHGVGSKQGSGVAVGRAAKYSETDLDKVPLRCYRETDID
EVLAEREEADSAIESQPSSEGPPGTTQPPASRPSPCPGPSSSLGSGNGDDEAGGEEDVDD
EVFEASEGARPGDHMPHSGLLKSPVPFLPGTSPSADGPDSFSCMFEAIMESHRAKGTSYS
SLASLEALASPGPTQSPFFTFEMPPQPPAPRPDPPAPAPLAPLEPDSGTSSVADGPWTQR
REVEESDAGATLAPRKELPSPSHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLAL
GSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFT
GMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLN
TDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSL
SELADPNPKVIKRVSGGSGSSSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKR
GWKSFHGILKGMILYLQKEEYQPGKALSEAELKNAISIHHALATRASDYSKRPHVFYLRT
ADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQE
EQVRTHEAKLKAMASELREHRAAHLGKKARGKEAEEQRQKETYLEFEKSRYGTYAALLRV
KMKAASEELDAIEAALAQAGSTEEGCPPPHSSPSLQPNPTSQPRAQRPGSEARAGAGSTR
PKP
Download sequence
Identical sequences G3V8J5
ENSRNOP00000026378 ENSRNOP00000051585 10116.ENSRNOP00000026378 NP_599197.2.100692 NP_599197.2.4139 XP_006231494.1.100692 XP_008758616.1.100692 XP_008758618.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]