SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026489 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026489
Domain Number 1 Region: 285-373
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 8.76e-35
Family Small-conductance potassium channel 0.0000756
Further Details:      
 
Domain Number 2 Region: 187-331
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-23
Family Voltage-gated potassium channels 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026489   Gene: ENSRNOG00000019440   Transcript: ENSRNOT00000026489
Sequence length 424
Comment pep:known chromosome:Rnor_5.0:1:82493757:82508465:1 gene:ENSRNOG00000019440 transcript:ENSRNOT00000026489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGELVTGLGALRRRKRLLEQEKRVAGWALVLAGTGIGLMVLHAEMLWFLGCKWVLYLLL
VKCLITLSTAFLLCLIVVFHAKEVQLFMTDNGLRDWRVALTRRQVAQILLELLVCGVHPV
PLRSPHCTLAGEATDSQAWPGFLGEGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSI
GALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLTDTLW
LIPITFLTIGYGDVVPGTLWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM
MDIHYAKEMKESAARLLQEAWMYYKHTRRKDSRAARRHQRKMLAAIHTFRQVRLKHRKLR
EQVNSMVDISKMHMILCDLQLGLSASHLALEKRIDGLAGKLDALTELLSTALQQQPPEPI
QEAT
Download sequence
Identical sequences A1A5N3
NP_001257630.1.100692 NP_001257630.1.4139 NP_075410.2.100692 NP_075410.2.4139 ENSRNOP00000026489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]