SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026666 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026666
Domain Number 1 Region: 141-406
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.06e-38
Family Eukaryotic proteases 0.00046
Further Details:      
 
Domain Number 2 Region: 46-108
Classification Level Classification E-value
Superfamily GLA-domain 1.08e-24
Family GLA-domain 0.00041
Further Details:      
 
Domain Number 3 Region: 97-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000577
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026666   Gene: ENSRNOG00000019700   Transcript: ENSRNOT00000026666
Sequence length 406
Comment pep:known chromosome:Rnor_5.0:16:81271366:81283180:-1 gene:ENSRNOG00000019700 transcript:ENSRNOT00000026666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADCISLHRGFILSFVLTLALHQVELSVFLPASEANNILLRWRRASSYLLEEFLQGNLER
ECYEEICNLEEAREVFENDASTDEFWSQYSGGFPCISQPCLNNGTCKDHIRSFSCTCAPG
YEGKTCAMAKNECHLERTDGCQHFCHPGQSSYMCSCAKGYKLGEDHRSCSPSDKCACGAL
TSQHIRTQMTDDICRSWPSFPWQVRLTNSEGEDFCAGVLLQENFVLTTAKCSLLHSNLSV
KADDDQQIRIKSAHVHMRYDKETGENDVSLLELEKPLQCPIPALPVCVPERDFAEHVLIP
GTKGVLSGWMLNGIDLDRTLTMLSVTQTDGEECGQILNVTVTTRTSCEKGSEVMGPWVEG
SVVTRQHKGTWFLTGILSSPPPPGQSHMLLLTSVPRYSMWFNQIMK
Download sequence
Identical sequences G3V8K8
NP_001296362.1.100692 NP_001296362.1.4139 ENSRNOP00000026666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]