SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026862 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026862
Domain Number 1 Region: 205-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-70
Family Nuclear receptor ligand-binding domain 0.00000000048
Further Details:      
 
Domain Number 2 Region: 76-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.81e-26
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026862   Gene: ENSRNOG00000019812   Transcript: ENSRNOT00000026862
Sequence length 446
Comment pep:known chromosome:Rnor_5.0:1:101619967:101625287:-1 gene:ENSRNOG00000019812 transcript:ENSRNOT00000026862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPTSSLDTPLPGNGSPQPSTSSTSPTIKEEGQETDPPPGSEGSSSAYIVVILEPEDEP
ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSG
TCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKKIQKQQQQQPPPPTEPASGSS
ARPAASPGTSEASSQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLG
ADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLE
TARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIA
INIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVH
SEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences Q62755
10116.ENSRNOP00000026862 ENSRNOP00000026862 ENSRNOP00000026862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]