SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027062 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027062
Domain Number 1 Region: 287-543
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-55
Family Voltage-gated potassium channels 0.00096
Further Details:      
 
Domain Number 2 Region: 90-194
Classification Level Classification E-value
Superfamily POZ domain 1.15e-31
Family Tetramerization domain of potassium channels 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027062   Gene: ENSRNOG00000019959   Transcript: ENSRNOT00000027062
Sequence length 889
Comment pep:known chromosome:Rnor_5.0:1:101659056:101669458:1 gene:ENSRNOG00000019959 transcript:ENSRNOT00000027062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSVCVWSFSGRQGTRKQHSQPAPTPQPPESSPPPLLPPPQQQCAQPGTAASPAGAPLS
CGPGGRRAEPCSGLPAVAMGRHGGGGGDSGKIVINVGGVRHETYRSTLRTLPGTRLAGLT
EPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDE
TDVEACCWMTYRQHRDAEEALDSFEAPDSSGNANANAGGAHDAGLDDEAGAGGGGLDGAG
GELKRLCFQDAGGGAGGPAGGPGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFF
ILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWF
TFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFV
RILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDI
LGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIV
NNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGISPPPP
ITPPSMGVTVAGAYPPGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIETNRA
GNDLGVLEEGVDPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACF
LVTDYAPSPDGSIRKATGAPPPPHAGVSQAPPASCPTSTPTQQPGYPPSGRAPSPPRATP
EAPAIFDVWLPPFHRSHQPPGKHQRGGRHPGVSPSPQQRACVGEPPSASHPQSLTLCISV
PSSCHRLRPRETLGFPLSLPPRLATGNGGRECPRDPGLPFPSRHSSPAV
Download sequence
Identical sequences ENSRNOP00000027062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]