SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027100 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027100
Domain Number 1 Region: 29-126
Classification Level Classification E-value
Superfamily Snake toxin-like 2.31e-25
Family Extracellular domain of cell surface receptors 0.025
Further Details:      
 
Domain Number 2 Region: 138-226
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000467
Family Snake venom toxins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027100   Gene: ENSRNOG00000019999   Transcript: ENSRNOT00000027100
Sequence length 352
Comment pep:known chromosome:Rnor_5.0:1:82757258:82761708:1 gene:ENSRNOG00000019999 transcript:ENSRNOT00000027100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAARRGDTQPVMWTTRWLLLLPLLLCEGAQALECYSCVQKADDGCSPHKMKTVKCGPGV
DVCTEAVGAVESIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFIQLQQCTEDRCNAKLN
LTLRGLNPAGNESAYEHNGAECYSCMGLSREKCQGAMPPVVNCYNASGRVYKGCFDGNVT
LTAANVTVSLPVRGCVQDEACTRDGVTGPGFTLSGSCCQGPRCNSDLRNKTYFSPRIPPL
VLLPPPTTPAPSTRTQNSSSTTSTTAPTTATTTIKPTTVQASHTSSTHETEHEVIQEEGS
HLSGGATGHQDRSNMGKFPEKGGAQIPSKGGSDALGSWLSAILLTVVAGAML
Download sequence
Identical sequences O55162
10116.ENSRNOP00000027100 NP_068527.1.100692 NP_068527.1.4139 ENSRNOP00000027100 ENSRNOP00000027100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]