SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028117 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028117
Domain Number 1 Region: 231-322
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.62e-41
Family Small-conductance potassium channel 0.00000385
Further Details:      
 
Domain Number 2 Region: 100-272
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028117   Gene: ENSRNOG00000020706   Transcript: ENSRNOT00000028117
Sequence length 418
Comment pep:known chromosome:Rnor_5.0:2:208267083:208411808:1 gene:ENSRNOG00000020706 transcript:ENSRNOT00000028117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVC
AIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDAS
SRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSN
FLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEK
HVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRG
VKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSL
PLLIADTLRQQQQQLLTAFVEARGISVAVGTSHAPPSDSPIGISSTSFPTPYTSSSSC
Download sequence
Identical sequences XP_015850684.1.50099 XP_017446542.1.100692 ENSRNOP00000028117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]