SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028189 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028189
Domain Number 1 Region: 171-199,234-431
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-57
Family Voltage-gated potassium channels 0.00084
Further Details:      
 
Domain Number 2 Region: 45-139
Classification Level Classification E-value
Superfamily POZ domain 6.28e-25
Family Tetramerization domain of potassium channels 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028189   Gene: ENSRNOG00000020779   Transcript: ENSRNOT00000028189
Sequence length 489
Comment pep:known chromosome:Rnor_5.0:1:102477238:102482730:1 gene:ENSRNOG00000020779 transcript:ENSRNOT00000028189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFLRADTGHPAGVAAASGPHVRSPVARAVRAMEPRCPPPCGCCERLVLNVAGLRFETRA
RTLGRFPDTLLGDPVRRSRFYDGARREYFFDRHRPSFDAVLYYYQSGGRLRRPAHVPLDV
FLEEVSFYGLGAAALARLREDEGCAVPPERPLPRRAFARQLWLLFEFPESSQAARVLAVV
SVLVILVSIVVFCLETLPDFRDDRDDPGLAPVAAATGSFLARLNGSSPMPGAPSRQPFND
PFFVVETLCICWFSFELLVRLAACPSKAVFFKNVMNLIDFVAILPYFVALGTELARQRGV
GQPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFS
SAVYFAEVDRADTHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTIS
LPVPVIVSNFSYFYHRETEGEEAGMYSHVDTQPCGTLEGKANGGLVDSEVPELLPPLWAP
SGKHMVTEV
Download sequence
Identical sequences D4A810
10116.ENSRNOP00000028189 ENSRNOP00000028189 NP_001102384.1.100692 NP_001102384.1.4139 ENSRNOP00000028189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]